DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33644 and CG33920

DIOPT Version :10

Sequence 1:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:161 Identity:33/161 - (20%)
Similarity:63/161 - (39%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRK-EVNDVRGAYVFSFKQGKS----II 65
            |.|.|.....::.....|.:  ||.|...|..|.:..|.| .:..:.|..:..|.....    :.
  Fly    28 TNIMCNSLDKQFSDFEYCYI--KSVNRSYKYVSIKAKLFKTPITKINGVILKRFNGYNGYRPFMF 90

  Fly    66 NYTAMEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTIN------PKVI 124
            |.|   :|.|:.::..:|..:...:.|.:|..:|...|||:  :....:::..|:      .||:
  Fly    91 NIT---LDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPY--DHDLVIEKLPIHFVNHQVTKVL 150

  Fly   125 PSYTPEMIFTSDCNIFIKKRRAMQLTIHGRV 155
            |  .||..:..:.|......|...:.::|.:
  Fly   151 P--VPEGDYLYETNWMAYDIRRAVVKVYGTI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33644NP_001027259.1 DUF1091 64..133 CDD:461928 17/74 (23%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 19/93 (20%)

Return to query results.
Submit another query.