DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33644 and CG33752

DIOPT Version :10

Sequence 1:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:147 Identity:29/147 - (19%)
Similarity:59/147 - (40%) Gaps:31/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TQIECPIHSPEYVQNFSCRL------------HKKSPNSGSKSFSAEFSLRKEVNDVRGAYVFSF 58
            |.::|.:....:.:...|:|            :.|......|..|..|::.|:::   |.:.|.|
  Fly    27 TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLS---GYHPFLF 88

  Fly    59 KQGKSIINYTAMEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYY---VDEFTIN 120
                   |.|   :|:|..:.......:|......::..|||..:||:.:::.|:   |.:|.:.
  Fly    89 -------NVT---VDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLT 143

  Fly   121 PKV---IPSYTPEMIFT 134
            ..:   ||..|...:|:
  Fly   144 DTMFAKIPLPTGNYMFS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33644NP_001027259.1 DUF1091 64..133 CDD:461928 16/74 (22%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 21/99 (21%)

Return to query results.
Submit another query.