DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33644 and CG33927

DIOPT Version :10

Sequence 1:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:106 Identity:22/106 - (20%)
Similarity:45/106 - (42%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRKEVNDVR-GAYVFSFKQGKS--IINY 67
            |...|...:..::....|||  |:...|:.:.|...::.|.::..| ...:|....|..  :.|.
  Fly    31 TNFVCDSVNETWLAVHQCRL--KAIRRGTTTLSFNGTVLKTISKFRVHGQIFKRANGFKPWLYNI 93

  Fly    68 TAMEIDYCQAL-SALQSQILFKLIADELRRVSNFPLNCPFV 107
            |   .|.|:.| ...::.::  ::.:.|:..||....||::
  Fly    94 T---FDGCRFLRKPYEAPVI--IVFNLLKSFSNLNFTCPYM 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33644NP_001027259.1 DUF1091 64..133 CDD:461928 10/45 (22%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 12/60 (20%)

Return to query results.
Submit another query.