DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33644 and CG33642

DIOPT Version :9

Sequence 1:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:145 Identity:32/145 - (22%)
Similarity:63/145 - (43%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EYVQNFSCRLHKKSPNSGSKSF-SAEFSLRKEVNDVRGAYVFSF---KQGKSIINYTAMEIDYCQ 76
            :.:|:...|:    .|..::|: :.|..::.:|.|:.......|   ...|.|..|.. .:|.||
  Fly    43 DLIQHIDFRI----VNLNNRSYVNGEMIVKSDVEDILMHTTMDFWKTSNQKKIKLYDG-RLDACQ 102

  Fly    77 ALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTINPKVIPSYTPEMIFTSDCNIFI 141
            .|.......|||:.....::..:..|:||...|..|.:..:.::.|.:|.:.|...|.:....|.
  Fly   103 FLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNYTLTNWHMDEKDLPPFVPLGTFRTVTEYFT 167

  Fly   142 KKRRAMQLTIHGRVV 156
            :.|.|:::...|:|:
  Fly   168 QDRLALRIVTQGKVL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 19/85 (22%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.