DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and HNRNPDL

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens


Alignment Length:75 Identity:23/75 - (30%)
Similarity:43/75 - (57%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80
            ::|:|.|.|....::|..|...||.||...:..|..||.|:|:|||.|....:::|:...::|.|
Human   149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213

  Fly    81 EGNYLNIQKS 90
            :|..::.:::
Human   214 DGKLIDPKRA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 23/71 (32%)
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120
RRM1_hnRPDL 149..224 CDD:410152 23/75 (31%)
RRM2_hnRPDL 234..308 CDD:409998
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420
Necessary for its nuclear import and export 396..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.