DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and SGN1

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_012266.1 Gene:SGN1 / 854817 SGDID:S000001440 Length:250 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:22/72 - (30%)
Similarity:40/72 - (55%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VAKVGKSVHR-------IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFN 64
            ::|..|..|:       |||||:...|..:::..:|::.|::....:::|:.||..||||::.|.
Yeast    49 LSKEEKHAHQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFE 113

  Fly    65 SLTALEK 71
            |....||
Yeast   114 SPAYREK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 19/63 (30%)
SGN1NP_012266.1 PABP-1234 <52..>202 CDD:130689 21/69 (30%)
RRM_II_PABPs 65..137 CDD:409747 19/56 (34%)

Return to query results.
Submit another query.