DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and SNP1

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:60 Identity:23/60 - (38%)
Similarity:35/60 - (58%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSF----NSLTALEKI 72
            ||:|.||:.:...||:.||.:||.:....::.||.|..||||.|:.|    :|..|.::|
Yeast   109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 23/60 (38%)
SNP1NP_012203.1 U1snRNP70_N 6..97 CDD:432406
RRM_SNP1_like 89..201 CDD:410194 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.