DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and GR-RBP5

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_177563.1 Gene:GR-RBP5 / 843763 AraportID:AT1G74230 Length:289 Species:Arabidopsis thaliana


Alignment Length:104 Identity:31/104 - (29%)
Similarity:50/104 - (48%) Gaps:27/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAVAKVGK----------------------SVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVI 47
            |.::|||:                      |..:||||.:.::.....||..|.::|.||.|.:|
plant     2 AFLSKVGRLFSQTSSHVTASSSMLQSIRCMSSSKIFVGGISYSTDEFGLREAFSKYGEVVDAKII 66

  Fly    48 FDKRTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLN 86
            .|:.||.|:|:.||:|   |:.|:..|..:  |:|..|:
plant    67 VDRETGRSRGFAFVTF---TSTEEASNAMQ--LDGQDLH 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 26/71 (37%)
GR-RBP5NP_177563.1 RRM 33..111 CDD:440488 26/73 (36%)

Return to query results.
Submit another query.