DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and AT1G20880

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_564127.1 Gene:AT1G20880 / 838681 AraportID:AT1G20880 Length:274 Species:Arabidopsis thaliana


Alignment Length:71 Identity:28/71 - (39%)
Similarity:41/71 - (57%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80
            ::|||.|.|....:.||.:|.::|.::.|.||.||.||.|||||||:|....|..:...:...|:
plant    25 KVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPII 89

  Fly    81 EGNYLN 86
            :|...|
plant    90 DGRRAN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 28/71 (39%)
AT1G20880NP_564127.1 RRM_RBM24_RBM38_like 24..99 CDD:409818 28/71 (39%)
PABP-1234 <37..246 CDD:130689 23/59 (39%)

Return to query results.
Submit another query.