DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and AT5G06210

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_196239.1 Gene:AT5G06210 / 830508 AraportID:AT5G06210 Length:146 Species:Arabidopsis thaliana


Alignment Length:106 Identity:32/106 - (30%)
Similarity:50/106 - (47%) Gaps:30/106 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAVAKVG----KSV------------------HRIFVGNLPWTVGHQELRGYFREFGRVVSANVI 47
            ||:|::|    |||                  .::|:|.|.:....|.|...|.:.|:||.|.::
plant     2 AALARIGGRHLKSVCLINSSASCFFTQRRGVASKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIV 66

  Fly    48 FDKRTGCSKGYGFVSFNSLTALEKIENEQKHILE--GNYLN 86
            .|:.:..|||:|||:|.|      .:..||.::|  |..||
plant    67 MDRVSDRSKGFGFVTFAS------ADEAQKALMEFNGQQLN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 25/73 (34%)
AT5G06210NP_196239.1 RRM_SF 34..113 CDD:473069 25/74 (34%)

Return to query results.
Submit another query.