DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and pabpn1l

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:XP_021333291.1 Gene:pabpn1l / 796580 ZFINID:ZDB-GENE-080709-5 Length:166 Species:Danio rerio


Alignment Length:71 Identity:16/71 - (22%)
Similarity:33/71 - (46%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHILE 81
            |:|||:.:.....||..||...|.|....:.:::.||..||:.::.|:...::.......:.:..
Zfish    39 IYVGNVDYGATADELEMYFNSCGHVNRVTIPYNRFTGHPKGFAYIEFSDRESVRTAMALDETLFR 103

  Fly    82 GNYLNI 87
            |..:.:
Zfish   104 GRVIKV 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 16/71 (23%)
pabpn1lXP_021333291.1 RRM_SF 38..113 CDD:473069 16/71 (23%)

Return to query results.
Submit another query.