DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Rbm28

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_598686.2 Gene:Rbm28 / 68272 MGIID:2655711 Length:750 Species:Mus musculus


Alignment Length:73 Identity:21/73 - (28%)
Similarity:38/73 - (52%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHI-- 79
            :|||.||.:....:|...|.:.|.|....|:.:|.:...:|:|:|:|   :.||.::...|.|  
Mouse     6 LFVGRLPPSARSDQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTF---SMLEDVQRALKEITT 67

  Fly    80 LEGNYLNI 87
            .||..:::
Mouse    68 FEGCKIDV 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 21/73 (29%)
Rbm28NP_598686.2 RRM1_RBM28_like 5..81 CDD:409847 21/73 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..110
RRM2_RBM28_like 115..190 CDD:409848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..320
RRM3_RBM28_like 325..407 CDD:409849
RRM4_RBM28_like 477..571 CDD:409850
PTZ00108 <563..740 CDD:240271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..716
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.