DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and RBM28

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_060547.2 Gene:RBM28 / 55131 HGNCID:21863 Length:759 Species:Homo sapiens


Alignment Length:73 Identity:22/73 - (30%)
Similarity:39/73 - (53%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHI-- 79
            :|||.||.:...::|...|.:.|.|....|:.:|.:...:|:|:|:|   :.||.::...|.|  
Human     6 LFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTF---SMLEDVQRALKEITT 67

  Fly    80 LEGNYLNI 87
            .||..:|:
Human    68 FEGCKINV 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 22/73 (30%)
RBM28NP_060547.2 RRM1_RBM28_like 5..81 CDD:409847 22/73 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..105
RRM2_RBM28_like 115..190 CDD:409848
PABP-1234 126..721 CDD:130689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..330
RRM3_RBM28_like 335..417 CDD:409849
RRM4_RBM28_like 487..581 CDD:409850
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..759
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.