DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Rbp4

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster


Alignment Length:77 Identity:23/77 - (29%)
Similarity:45/77 - (58%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVAKVG-KSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTAL 69
            |:.:.| :.:.:||:|.|......:.|||:|.:||.|..|.|:.|..:..|:|:|||::....::
  Fly    22 AIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSV 86

  Fly    70 EKIENEQKHILE 81
            |.::..:.|.::
  Fly    87 EIVQRARPHTID 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 21/66 (32%)
Rbp4NP_476935.1 RRM_SF 34..105 CDD:473069 21/65 (32%)
RRM2_hnRNPA_like 137..209 CDD:409766
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.