DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Rbm38

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:XP_063140362.1 Gene:Rbm38 / 366262 RGDID:1308503 Length:266 Species:Rattus norvegicus


Alignment Length:59 Identity:27/59 - (45%)
Similarity:35/59 - (59%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIEN 74
            :||||.||:......||.||..||.:..|.||.|::||.|:|||   |..:.|||..:|
  Rat    33 KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYG---FGIVAALEGTQN 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 27/59 (46%)
Rbm38XP_063140362.1 None

Return to query results.
Submit another query.