DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Hnrnpa3

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_937765.1 Gene:Hnrnpa3 / 362152 RGDID:727807 Length:379 Species:Rattus norvegicus


Alignment Length:78 Identity:22/78 - (28%)
Similarity:47/78 - (60%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQK 77
            :|.:||||.:........||.||.::|::.:..|:.|:::|..:|:.||:|:....::||..::.
  Rat   124 TVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188

  Fly    78 HILEGNYLNIQKS 90
            |.:.|:...::|:
  Rat   189 HTINGHNCEVKKA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 20/71 (28%)
Hnrnpa3NP_937765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
RRM1_hnRNPA_like 36..113 CDD:409992
RRM2_hnRNPA3 126..205 CDD:409996 21/76 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225
HnRNPA1 332..>348 CDD:463312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..379
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.