DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Caper

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster


Alignment Length:76 Identity:25/76 - (32%)
Similarity:44/76 - (57%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSL----TALEKIENEQ 76
            |::||:|.:.:....|||.|..||::.:..:|.|..||.||||||:::::.    .|||::...:
  Fly   336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFE 400

  Fly    77 KHILEGNYLNI 87
               |.|..:.:
  Fly   401 ---LAGRLMKV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 25/76 (33%)
CaperNP_609095.1 SF-CC1 213..578 CDD:273721 25/76 (33%)

Return to query results.
Submit another query.