DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Secp43

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster


Alignment Length:65 Identity:26/65 - (40%)
Similarity:34/65 - (52%) Gaps:9/65 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IFVGNLPWTVGHQELRGYF-REFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80
            ::||:|...|...:|...| .:|..:.:|.||.|. .|.|||||||.|.       ||:|||..|
  Fly   102 VWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDS-LGFSKGYGFVRFG-------IEDEQKSAL 158

  Fly    81  80
              Fly   159  158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 26/65 (40%)
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022
RRM2_SECp43_like 99..178 CDD:409781 26/65 (40%)
Trnau1ap 210..330 CDD:465438
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.