DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and HNRNPD

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_112738.1 Gene:HNRNPD / 3184 HGNCID:5036 Length:355 Species:Homo sapiens


Alignment Length:86 Identity:27/86 - (31%)
Similarity:52/86 - (60%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTAL 69
            ||.|:  :...::|:|.|.|....::|:.||.:||.||...:..|..||.|:|:|||.|....::
Human    89 AATAQ--REEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESV 151

  Fly    70 EKIENEQKHILEGNYLNIQKS 90
            :|:.::::|.|.|..::.:::
Human   152 DKVMDQKEHKLNGKVIDPKRA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 24/71 (34%)
HNRNPDNP_112738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 2/2 (100%)
CBFNT <60..78 CDD:311868
RRM1_hnRNPD 99..172 CDD:410150 24/72 (33%)
RRM2_hnRNPD 183..257 CDD:241027
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.