DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and HNRNPAB

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:75 Identity:26/75 - (34%)
Similarity:48/75 - (64%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80
            ::|||.|.|....::|:.||.:||.||...:..|..||.|:|:||:.|....::||:.::::|.|
Human    71 KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135

  Fly    81 EGNYLNIQKS 90
            :|..::.:|:
Human   136 DGRVIDPKKA 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 25/71 (35%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868
RRM1_hnRNPAB 66..145 CDD:410151 25/73 (34%)
RRM2_hnRNPAB 150..229 CDD:409997
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.