DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Rbm28

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001402807.1 Gene:Rbm28 / 312182 RGDID:1311336 Length:753 Species:Rattus norvegicus


Alignment Length:73 Identity:22/73 - (30%)
Similarity:38/73 - (52%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHI-- 79
            :|||.||.:....:|...|.:.|.|....|:.:|.:...:|:|:|:|   :.||.::...|.|  
  Rat     6 LFVGRLPPSARSDQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTF---SMLEDVQRALKEITT 67

  Fly    80 LEGNYLNI 87
            .||..:|:
  Rat    68 FEGCKINV 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 22/73 (30%)
Rbm28NP_001402807.1 RRM1_RBM28_like 5..78 CDD:409847 22/73 (30%)
RRM2_RBM28_like 115..190 CDD:409848
PABP-1234 322..709 CDD:130689
RRM3_RBM28_like 329..411 CDD:409849
RRM4_RBM28_like 481..575 CDD:409850
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.