DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP1 and Msi1

DIOPT Version :10

Sequence 1:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_032655.1 Gene:Msi1 / 17690 MGIID:107376 Length:362 Species:Mus musculus


Alignment Length:85 Identity:27/85 - (31%)
Similarity:46/85 - (54%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALE 70
            |..|:.....:||||.|......::::.||.:||:|..|.::|||.|...:|:|||:|.|...:|
Mouse   100 AQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVE 164

  Fly    71 KIENEQKHILEGNYLNIQKS 90
            |:.....|.:....:..:|:
Mouse   165 KVCEIHFHEINNKMVECKKA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 24/71 (34%)
Msi1NP_032655.1 RRM1_MSI 21..96 CDD:409990
PABP-1234 <32..312 CDD:130689 27/85 (32%)
RRM2_MSI 110..183 CDD:240769 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.