DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skel and Thbd

DIOPT Version :10

Sequence 1:NP_001247027.1 Gene:Skel / 3772559 FlyBaseID:FBgn0262717 Length:1503 Species:Drosophila melanogaster
Sequence 2:NP_113959.1 Gene:Thbd / 83580 RGDID:621299 Length:577 Species:Rattus norvegicus


Alignment Length:156 Identity:32/156 - (20%)
Similarity:55/156 - (35%) Gaps:61/156 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 VAGESIVVQLVAKLEPNHYMSFGISPNKNISQMIGADAVVAWVDPQTGNGFATDYFLEGKAQCSG 359
            :|...:.:..:|||:|..            ||.:|.:....:.||.|        ||:....|..
  Rat    10 LAPAGLGISALAKLQPKG------------SQCVGNECFALFQDPVT--------FLDASQACQR 54

  Fly   360 GRGACPDTKISEKTNSIRLLNAAMVNGYSIVTYQRSLAATDRLDLPISITGAESVVWA------- 417
            .:|                         .::|.:.|:|| |.:.|.:|.:..:|..|.       
  Rat    55 LQG-------------------------HLMTVRSSVAA-DVISLLVSDSSMDSRPWIGLQLPQG 93

  Fly   418 ------IGPLNDYQEVS--FHTFYNK 435
                  :|||..:|.|:  .||.|::
  Rat    94 CGDPVHLGPLRGFQWVTGDNHTSYSR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkelNP_001247027.1 DM13 42..149 CDD:128929
DM13 158..264 CDD:128929
DoH 286..447 CDD:214768 32/156 (21%)
ThbdNP_113959.1 CLECT 30..169 CDD:470576 25/124 (20%)
FXa_inhibition 244..279 CDD:464251
FXa_inhibition 288..322 CDD:464251
EGF_CA 324..353 CDD:429571
Tme5_EGF_like 405..438 CDD:312559
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.