DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Skeletor and THBD

DIOPT Version :9

Sequence 1:	NP_001247027.1	Gene:	Skeletor / 3772559	FlyBaseID:	FBgn0262717	Length:	1503	Species:	Drosophila melanogaster
Sequence 2:	NP_000352.1	Gene:	THBD / 7056	HGNCID:	11784	Length:	575	Species:	Homo sapiens

Alignment Length:	135	Identity:	34/135 - (25%)
Similarity:	45/135 - (33%)	Gaps:	35/135 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   448 WNCPLPEGARGNSNSSEQEDSAPAAQSSTGGAGYPPAGR-------------------PNVEPDE 493
            |:|.:..|  |..::......||..| ...||.....||                   ||  ||:
Human   243 WDCSVENG--GCEHACNAIPGAPRCQ-CPAGAALQADGRSCTASATQSCNDLCEHFCVPN--PDQ 302

  Fly   494 E-FYENRAEALHR-QPPQRRQETAIITQRRPVPTP-KPVNSNGA--------WDIPAIQCHEPED 547
            . .|....|..:| ...|.|.|........|.|.| :.||:.|.        :|:...:|.||.|
Human   303 PGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVD 367

  Fly   548 GVFYA 552
            ..|.|
Human   368 PCFRA 372

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Skeletor	NP_001247027.1	DM13	42..149	CDD:128929
		DM13	158..264	CDD:128929
		DoH	286..447	CDD:214768
THBD	NP_000352.1	CLECT_thrombomodulin_like	30..171	CDD:153070
		FXa_inhibition	245..280	CDD:291342	10/37 (27%)
		FXa_inhibition	289..323	CDD:291342	8/35 (23%)
		EGF_CA	325..>355	CDD:214542	6/29 (21%)
		Tme5_EGF_like	406..439	CDD:286192
		EGF_CA	441..>468	CDD:214542
		Involved in alpha-L/beta-2 and alpha-M/beta-2 integrin binding. /evidence=ECO:0000269\|PubMed:27055590	481..515
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	484..506
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24036
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100