DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skeletor and Thbd

DIOPT Version :9

Sequence 1:NP_001247027.1 Gene:Skeletor / 3772559 FlyBaseID:FBgn0262717 Length:1503 Species:Drosophila melanogaster
Sequence 2:NP_033404.1 Gene:Thbd / 21824 MGIID:98736 Length:577 Species:Mus musculus


Alignment Length:322 Identity:64/322 - (19%)
Similarity:99/322 - (30%) Gaps:127/322 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 VAGESIVVQLVAKLEPNHYMSFGISPNKNISQMIGADAVVAWVDPQTGNGFATDYFLEGKAQCSG 359
            :|..|:.:..:|||:|..            ||.:..:....:..|.|        ||:....|..
Mouse    10 LAPASLGLSALAKLQPTG------------SQCVEHECFALFQGPAT--------FLDASQACQR 54

  Fly   360 GRGACPDTKISEKTNSIRLLNAAMVNGYSIVTYQRSLAATDRLDLPISITGAESVVWA------- 417
            .:|                         .::|.:.|:|| |.:.|.:|.:..:...|.       
Mouse    55 LQG-------------------------HLMTVRSSVAA-DVISLLLSQSSMDLGPWIGLQLPQG 93

  Fly   418 ------IGPLNDYQEVS--FHTFYNKHLHQIEFGRQPKWNCPLPEGARGNSNSSEQEDSAP---- 470
                  :|||..:|.|:  .||.|:            :|       ||.|      :.:||    
Mouse    94 CDDPVHLGPLRGFQWVTGDNHTSYS------------RW-------ARPN------DQTAPLCGP 133

  Fly   471 ---AAQSSTGGAGYPPAGRPNVEPDE--------EFY---ENRAEALHRQPPQRRQETAIITQRR 521
               ...::|..|...||...  :|.|        |||   ..|...::.:.|    |.|.|:...
Mouse   134 LCVTVSTATEAAPGEPAWEE--KPCETETQGFLCEFYFTASCRPLTVNTRDP----EAAHISSTY 192

  Fly   522 PVP--------TPKPVNSNGAWDIPAIQCHEPEDGVFYAQMGPTGGKHGYPAITGHVGWGIS 575
            ..|        ...||.|:.|        .||. |:......|.|...|:.|......|..|
Mouse   193 NTPFGVSGADFQTLPVGSSAA--------VEPL-GLELVCRAPPGTSEGHWAWEATGAWNCS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkeletorNP_001247027.1 DM13 42..149 CDD:128929
DM13 158..264 CDD:128929
DoH 286..447 CDD:214768 30/166 (18%)
ThbdNP_033404.1 CLECT 30..169 CDD:295302 36/199 (18%)
FXa_inhibition 244..279 CDD:291342 1/2 (50%)
FXa_inhibition 291..322 CDD:291342
EGF_CA 324..360 CDD:284955
Plasmod_Pvs28 346..467 CDD:283826
Tme5_EGF_like 405..438 CDD:286192
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24036
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.