DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skeletor and H06A10.1

DIOPT Version :9

Sequence 1:NP_001247027.1 Gene:Skeletor / 3772559 FlyBaseID:FBgn0262717 Length:1503 Species:Drosophila melanogaster
Sequence 2:NP_510255.1 Gene:H06A10.1 / 186696 WormBaseID:WBGene00010368 Length:291 Species:Caenorhabditis elegans


Alignment Length:324 Identity:78/324 - (24%)
Similarity:131/324 - (40%) Gaps:80/324 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MKDKPWLLLF-----GLLAALSCLASFGDAAYPYYGTKIGALTRLHHGVSGDVYAVDSRTIFIKK 63
            |::..:.|:|     |::.|:.           |.|..:|..:  ...|.|:|:.|:|..:.|..
 Worm     1 MRNSEFFLIFIISYSGVIRAIE-----------YNGVSLGEFS--ESDVEGEVFLVNSTHLQIVN 52

  Fly    64 F--NYDGEAPAAYFYVGNTARPSNEGAARLRDERGG-----TASLTRRYRNKDVTLSLPEGKTLR 121
            |  ......|..:.::.:..:.|.....|....:.|     ..||:......|..|.:.  .|..
 Worm    53 FRTTKTNLPPIPFAFISSNNQKSTPKIYRHFSSQNGEWLSKLVSLSHEQHQIDTRLIVK--MTGS 115

  Fly   122 DIKWFSVWCDEFAV--NFGDVSIPPNLDFPRPQKISA------------LRGVHGVSSDNIVIVD 172
            ..:|     .:|||  :.|:.....|::    ||.||            |.|.:|:.||.|.::|
 Worm   116 AAQW-----KQFAVVDSNGNTLASVNMN----QKPSAPFCCFESEADMGLFGEYGIISDPIEVID 171

  Fly   173 AQTLLVPNFSYD-GEAPDAKFWVGRGQRPTSDGLRIPDENGKENPLRRYER-------------K 223
            ::||.:|.|||. .:.||..|:.|.|.       .|..::||:..:.|.::             :
 Worm   172 SRTLKIPKFSYKASQTPDGYFFAGAGS-------EIDQKSGKKAAILRSDQTLNYCPMLKDITDQ 229

  Fly   224 TIVLTLPEDLTIFDIGHFGVWCEAFTVDFGHVRLPEGL-----NVPPSLKMLGISPQSKL--NC 280
            .|::.|.:..||:||....|:|..::.||||  |..||     .|||.:..:.||....:  ||
 Worm   230 DIIIRLDQSQTIYDIEWISVFCYKYSHDFGH--LDMGLVENEEQVPPYIPDISISEPHVISQNC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkeletorNP_001247027.1 DM13 42..149 CDD:128929 22/115 (19%)
DM13 158..264 CDD:128929 36/124 (29%)
DoH 286..447 CDD:214768
H06A10.1NP_510255.1 DM13 157..270 CDD:128929 36/121 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 0.167 Domainoid score I6519
eggNOG 1 0.900 - - E1_KOG4731
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D320761at33208
OrthoFinder 1 1.000 - - FOG0005930
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.