DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33856 and HTA10

DIOPT Version :10

Sequence 1:NP_001027371.1 Gene:His2A:CG33856 / 3772556 FlyBaseID:FBgn0053856 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_175517.1 Gene:HTA10 / 841528 AraportID:AT1G51060 Length:132 Species:Arabidopsis thaliana


Alignment Length:123 Identity:95/123 - (77%)
Similarity:106/123 - (86%) Gaps:4/123 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK---GGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV 62
            |:||||   .|..| ||.:||.:||||||||||.|.|:||.||||||||||||||||:|||||||
plant     1 MAGRGKTLGSGSAK-KATTRSSKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVLEYLAAEV 64

  Fly    63 LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120
            ||||||||||||||||:|||:|||:||||||:|||..||||.|||:|||..:||||||
plant    65 LELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKT 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33856NP_001027371.1 PTZ00017 16..124 CDD:185399 86/105 (82%)
HTA10NP_175517.1 PLN00157 1..132 CDD:177758 95/123 (77%)

Return to query results.
Submit another query.