DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33856 and HTA7

DIOPT Version :9

Sequence 1:NP_001027371.1 Gene:His2A:CG33856 / 3772556 FlyBaseID:FBgn0053856 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_198119.1 Gene:HTA7 / 832829 AraportID:AT5G27670 Length:150 Species:Arabidopsis thaliana


Alignment Length:120 Identity:90/120 - (75%)
Similarity:99/120 - (82%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RGKGGKVKG---KAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            ||.||:..|   |:.|:|.:||||||||||.|.|:||.||.|.|:|||||||||:||||||||||
plant    12 RGAGGRKGGDRKKSVSKSVKAGLQFPVGRIARYLKKGRYALRYGSGAPVYLAAVLEYLAAEVLEL 76

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120
            ||||||||||.||.||||.|||||||||.:||.|||||.|||||||..||||||:
plant    77 AGNAARDNKKNRINPRHLCLAIRNDEELGRLLHGVTIASGGVLPNINPVLLPKKS 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33856NP_001027371.1 H2A 16..121 CDD:197711 84/105 (80%)
H2A 16..119 CDD:238029 82/102 (80%)
HTA7NP_198119.1 PTZ00017 12..140 CDD:185399 90/120 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.