DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33856 and HTA2

DIOPT Version :10

Sequence 1:NP_001027371.1 Gene:His2A:CG33856 / 3772556 FlyBaseID:FBgn0053856 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_194453.1 Gene:HTA2 / 828831 AraportID:AT4G27230 Length:131 Species:Arabidopsis thaliana


Alignment Length:121 Identity:92/121 - (76%)
Similarity:103/121 - (85%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK--GGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63
            |:||||  |.....|:.|||.:||||||||||.|.|:.|.||||||||||||||||:||||||||
plant     1 MAGRGKQLGSGAAKKSTSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVL 65

  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119
            |||||||||||||||:|||:|||:||||||:|||..||||.|||:|||..:|||||
plant    66 ELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33856NP_001027371.1 PTZ00017 16..124 CDD:185399 85/104 (82%)
HTA2NP_194453.1 PLN00157 1..131 CDD:177758 92/121 (76%)

Return to query results.
Submit another query.