DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33856 and HTA4

DIOPT Version :10

Sequence 1:NP_001027371.1 Gene:His2A:CG33856 / 3772556 FlyBaseID:FBgn0053856 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001190717.1 Gene:HTA4 / 826990 AraportID:AT4G13570 Length:124 Species:Arabidopsis thaliana


Alignment Length:90 Identity:46/90 - (51%)
Similarity:61/90 - (67%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LQFPVGRIHRLLRKGNYA-ERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLA 86
            ::|.|.|||:.|:....| ..|||...||:.:::|||..|||:||.|.::|.|..||.|||||||
plant    35 IRFQVARIHKQLKNRVSAHSSVGATDVVYMTSILEYLTTEVLQLAENTSKDLKVKRITPRHLQLA 99

  Fly    87 IRNDEELNKLLSGVTIAQGGVLPNI 111
            ||.||||:.|:.| ||..|.|:|:|
plant   100 IRGDEELDTLIKG-TIIGGSVIPHI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33856NP_001027371.1 PTZ00017 16..124 CDD:185399 46/90 (51%)
HTA4NP_001190717.1 PLN00154 <35..124 CDD:177756 46/90 (51%)

Return to query results.
Submit another query.