DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33856 and H2ac23

DIOPT Version :10

Sequence 1:NP_001027371.1 Gene:His2A:CG33856 / 3772556 FlyBaseID:FBgn0053856 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001171015.1 Gene:H2ac23 / 665433 MGIID:2448302 Length:130 Species:Mus musculus


Alignment Length:32 Identity:7/32 - (21%)
Similarity:15/32 - (46%) Gaps:8/32 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GGEKKTIWIVEEEGKLSNKASTSRNFCLSPVD 113
            |..||.:.::::|..::        |.|..:|
Mouse   155 GDSKKQVPVLDKEKNIA--------FLLKELD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33856NP_001027371.1 PTZ00017 16..124 CDD:185399 7/32 (22%)
H2ac23NP_001171015.1 PTZ00017 1..130 CDD:185399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.