DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33856 and h2ac1

DIOPT Version :10

Sequence 1:NP_001027371.1 Gene:His2A:CG33856 / 3772556 FlyBaseID:FBgn0053856 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001025500.1 Gene:h2ac1 / 594915 XenbaseID:XB-GENE-5901183 Length:138 Species:Xenopus tropicalis


Alignment Length:126 Identity:95/126 - (75%)
Similarity:109/126 - (86%) Gaps:7/126 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVK----GKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE 61
            ||||||  ||:    ||: |||.:||||||||||||||||||||||:|:|:.:||||.:|||.||
 Frog     1 MSGRGK--KVQKAASGKS-SRSAKAGLQFPVGRIHRLLRKGNYAERIGSGSAIYLAATLEYLCAE 62

  Fly    62 VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122
            ||||||||||||||:||:|||:|||:|||:||.||..|||||.||||||||:.||||||.|
 Frog    63 VLELAGNAARDNKKSRILPRHIQLAVRNDDELAKLFDGVTIADGGVLPNIQSALLPKKTSK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33856NP_001027371.1 PTZ00017 16..124 CDD:185399 85/107 (79%)
h2ac1NP_001025500.1 H2A 17..121 CDD:197711 82/103 (80%)

Return to query results.
Submit another query.