DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33856 and Macroh2a2

DIOPT Version :10

Sequence 1:NP_001027371.1 Gene:His2A:CG33856 / 3772556 FlyBaseID:FBgn0053856 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001129279.1 Gene:Macroh2a2 / 361844 RGDID:1561371 Length:372 Species:Rattus norvegicus


Alignment Length:123 Identity:81/123 - (65%)
Similarity:92/123 - (74%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            ||||  .||.|....|||.|||:.|||||:.|.|:||.:..|:..|||||:|||:||||||:|||
  Rat     1 MSGR--SGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILEL 63

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
            ||||||||||.||.|||:.||:.||||||:||.|||||.|||||.|...||.||...|
  Rat    64 AGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33856NP_001027371.1 PTZ00017 16..124 CDD:185399 74/108 (69%)
Macroh2a2NP_001129279.1 H2A 14..119 CDD:197711 73/104 (70%)
Macro_H2A-like 178..368 CDD:394875
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.