DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33833 and AT5G10980

DIOPT Version :10

Sequence 1:NP_001027333.1 Gene:His3:CG33833 / 3772552 FlyBaseID:FBgn0053833 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_196659.1 Gene:AT5G10980 / 830965 AraportID:AT5G10980 Length:136 Species:Arabidopsis thaliana


Alignment Length:136 Identity:131/136 - (96%)
Similarity:134/136 - (98%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||.|||||||||||||||||||||:|||||||||||
plant     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||.||:|||||:|||||||||||||||||||||||||||||||||
plant    66 LPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
plant   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33833NP_001027333.1 PTZ00018 1..136 CDD:185400 129/134 (96%)
AT5G10980NP_196659.1 PTZ00018 1..136 CDD:185400 129/134 (96%)

Return to query results.
Submit another query.