DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Menl-1 and SPAC750.08c

DIOPT Version :9

Sequence 1:NP_001027428.1 Gene:Menl-1 / 3772542 FlyBaseID:FBgn0029154 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_595034.1 Gene:SPAC750.08c / 2542710 PomBaseID:SPAC750.08c Length:228 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:64/198 - (32%)
Similarity:100/198 - (50%) Gaps:6/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 NMKETKS----LETLVEQVKPSIIMGATSAPGLFTEKIIRTMAASHERPGIFAFSNPTIKSECTA 449
            :.||..|    |||.:..:||::::|.:..||.||||.||.|:...:.|.||..||||...|...
pombe    27 DFKEVPSGDIDLETAISLIKPTVLLGCSGQPGKFTEKAIREMSKHVKHPIIFPISNPTTLMEAKP 91

  Fly   450 EQAYKFSDGKAIYSAGSPFPPVEFNGKRLTPGQANNCFAFPALVLATMTVLATRMPDEIFLLAAH 514
            .|..::|:|||:.:.|||.||:..|||.....|.||...:|||.:|.:......:.|.:...|:.
pombe    92 VQIDEWSNGKALMATGSPLPPLTRNGKEYVISQCNNALLYPALGVACVLSRCKLLSDGMLKAASD 156

  Fly   515 ELAEFPTNEEMQSGRIYPLVKQANEVAYKIGVKVAKYLIENGYAKRNLEPED--VEEYIEKNSYK 577
            .||..|.:..:....:.|.:..|.|::..|...|.|..|..|.:..:|..:|  ::|:|.:..:.
pombe   157 ALATVPRSLFVADEALLPDLDNAREISRHIVFAVLKQAISEGMSTVDLPKDDAKLKEWIIEREWN 221

  Fly   578 LTY 580
            ..|
pombe   222 PEY 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Menl-1NP_001027428.1 PLN03129 35..582 CDD:215594 64/198 (32%)
malic 114..292 CDD:278802
NAD_bind_1_malic_enz 302..576 CDD:133454 63/192 (33%)
SPAC750.08cNP_595034.1 NADB_Rossmann <1..222 CDD:304358 63/194 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1122
eggNOG 1 0.900 - - E1_COG0281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000475
OrthoInspector 1 1.000 - - mtm9297
orthoMCL 1 0.900 - - OOG6_100205
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.