DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33820 and HTA10

DIOPT Version :9

Sequence 1:NP_001027311.1 Gene:His2A:CG33820 / 3772541 FlyBaseID:FBgn0053820 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_175517.1 Gene:HTA10 / 841528 AraportID:AT1G51060 Length:132 Species:Arabidopsis thaliana


Alignment Length:123 Identity:95/123 - (77%)
Similarity:107/123 - (86%) Gaps:4/123 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK---GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV 62
            |:||||   .|..| ||.:||::||||||||||.|.|:||.||||||||||||||||:|||||||
plant     1 MAGRGKTLGSGSAK-KATTRSSKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVLEYLAAEV 64

  Fly    63 LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120
            ||||||||||||||||:|||:|||:||||||:|||..||||.|||:|||..:||||||
plant    65 LELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKT 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33820NP_001027311.1 PTZ00017 16..124 CDD:185399 86/105 (82%)
HTA10NP_175517.1 PLN00157 1..132 CDD:177758 95/123 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1660
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I1426
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm981
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X55
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.