DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and SFT2D3

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_116129.3 Gene:SFT2D3 / 84826 HGNCID:28767 Length:215 Species:Homo sapiens


Alignment Length:156 Identity:62/156 - (39%)
Similarity:87/156 - (55%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SCFPKLSRLQRIVGFVACLGMGALCMTLSTFYIPFLILKARKFALLYTLGSLFFILSFCFLSG-- 113
            :|.|.::|.||:.....||.:.|||..|:..|.|.|:|:|||||||::|||...:.....|.|  
Human    66 TCLPSVTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALALAGSALLRGGA 130

  Fly   114 -FGSFLK--QMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLFMVLGTVP-G 174
             .|..|:  :..|:|.||    |.:.|..||:.||..:||..|||.|.||:.|||..::|.:| |
Human   131 ACGRLLRCEEAPSRPALL----YMAALGATLFAALGLRSTLLTVLGAGAQVAALLAALVGLLPWG 191

  Fly   175 GATGLKF-FGQLFKNTVSASTSVLPV 199
            |.|.|:. .|:|.:.  :....||||
Human   192 GGTALRLALGRLGRG--AGLAKVLPV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 49/116 (42%)
SFT2D3NP_116129.3 Got1 87..>172 CDD:282085 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38341
Inparanoid 1 1.050 86 1.000 Inparanoid score I5167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1371944at2759
OrthoFinder 1 1.000 - - FOG0004073
OrthoInspector 1 1.000 - - oto88706
orthoMCL 1 0.900 - - OOG6_103301
Panther 1 1.100 - - LDO PTHR23137
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1328
SonicParanoid 1 1.000 - - X4444
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.