DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and AT5G56020

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001330101.1 Gene:AT5G56020 / 835700 AraportID:AT5G56020 Length:230 Species:Arabidopsis thaliana


Alignment Length:166 Identity:48/166 - (28%)
Similarity:85/166 - (51%) Gaps:14/166 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSSDPEANSF----------LKDSDSCFPKLSRLQRIVGFVACLGMGALCMTLS-TFYIPFLILK 89
            |::|..:.:|          |:.:.|..|....|   :.|...|..|...:.:: |.::|.::|.
plant    62 SANDTVSGTFNVVSKGVRDNLQSATSSMPSGKAL---MYFGLLLASGVFFIFIAFTMFLPVMVLM 123

  Fly    90 ARKFALLYTLGSLFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTV 154
            .:|||:.:|||..|.|.||..|.|..:.|..|.|..||..:|.:.:.::.|:|.::|..|...:|
plant   124 PQKFAICFTLGCGFIIGSFFALRGPQNQLAHMSSAERLPLTLGFIATMVGTIYVSMVLHSYILSV 188

  Fly   155 LFAVAQIIALLFMVLGTVPGGATGLKFFGQLFKNTV 190
            :|:..|:|||.:..:...|||::|:||......::|
plant   189 IFSALQVIALAYYCISYFPGGSSGMKFLSSTLTSSV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 37/110 (34%)
AT5G56020NP_001330101.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3196
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1371944at2759
OrthoFinder 1 1.000 - - FOG0004073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103301
Panther 1 1.100 - - O PTHR23137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.