DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and AT5G24170

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_197805.2 Gene:AT5G24170 / 832484 AraportID:AT5G24170 Length:163 Species:Arabidopsis thaliana


Alignment Length:137 Identity:52/137 - (37%)
Similarity:69/137 - (50%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DPEANSFLKDSDSCFPKLSRLQRIVGFVACLGMGALCMTLS--TFYIPFLILKARKFALLYTLGS 101
            |...:|||:|.......||..||:.||.|.|..|.|.|.||  .|.||.      |||||:|.|:
plant    15 DGTTDSFLEDGSEGLCALSTTQRMYGFAASLATGLLLMFLSMIVFGIPI------KFALLFTFGN 73

  Fly   102 LFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLF 166
            :..|.|..||.|....:..||...|.|.:..|..|:::.|.|||:..|...|||..:.:|.||::
plant    74 VLAIGSTAFLMGPEQQMSMMFDPVRFLATSIYIGCVVVALICALLIHSKILTVLAILCEICALIW 138

  Fly   167 MVLGTVP 173
            ..|..:|
plant   139 YSLSYIP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 39/104 (38%)
AT5G24170NP_197805.2 Got1 43..156 CDD:398033 41/109 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54203
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.