DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and AT5G23550

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_197746.1 Gene:AT5G23550 / 832421 AraportID:AT5G23550 Length:175 Species:Arabidopsis thaliana


Alignment Length:145 Identity:43/145 - (29%)
Similarity:72/145 - (49%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSDPEAN-SFLKD-SDSCFPKLSRLQRIVGFVACLGMGALCMTLS--TFYIPFLILKARKFALLY 97
            ::|.|:: ||::| :.:|  .|:..||..||..||..|..|..||  .|:.|.      ||.:.:
plant    25 AADEESSLSFMEDLNRNC--ALTTKQRFYGFAICLSAGLTCTLLSMLVFFNPV------KFGITF 81

  Fly    98 TLGSLFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQII 162
            |||:|..:.|..||.|....:..|....|:..:..|.:.:|:.|:|||..::...|:|..:.:..
plant    82 TLGNLMALGSTAFLIGPQRQVTMMLDPARIYATALYLASIIIALFCALYVRNKLLTLLAIILEFT 146

  Fly   163 ALLFMVLGTVPGGAT 177
            .|::..|..:|...|
plant   147 GLIWYSLSYIPFART 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 30/108 (28%)
AT5G23550NP_197746.1 Got1 60..167 CDD:398033 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54203
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.