DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and AT4G26550

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_567749.1 Gene:AT4G26550 / 828761 AraportID:AT4G26550 Length:225 Species:Arabidopsis thaliana


Alignment Length:209 Identity:57/209 - (27%)
Similarity:103/209 - (49%) Gaps:28/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNLKSDLDEYLLLQS-DQKKPSFNVKLPQLKVPFFSSSDPEANSF-------------LKDSDSC 52
            |:|.:|.:.|...:. ::...||..   .::....|::|..:.:|             |:.:.|.
plant    22 SSLLADWNSYAASRDFEESGGSFGF---DIESAVRSANDTVSGTFSVVSKGVRDIPGSLQSATSS 83

  Fly    53 FPKLSRLQRIVGFVACLGMGALCMTLS-TFYIPFLILKARKFALLYTLGSLFFILSFCFLSGFGS 116
            .|....|   :.|...|..|...:.:: |.::|.::|..:|||:.:|||..|.|.||..|.|..:
plant    84 MPSGKAL---MYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFALRGPKN 145

  Fly   117 FLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLFMVLGTVPGGATGLKF 181
            .|..|.|..||.::|.:.:.::.|:|.::|..|...:|||:|.|::||::..:...|||::|::|
plant   146 QLAHMSSMERLPSTLGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALVYYCISYFPGGSSGMRF 210

  Fly   182 FGQLFKNTVSASTS 195
            ..       ||.||
plant   211 LS-------SALTS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 37/110 (34%)
AT4G26550NP_567749.1 Got1 100..213 CDD:398033 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3196
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1371944at2759
OrthoFinder 1 1.000 - - FOG0004073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103301
Panther 1 1.100 - - LDO PTHR23137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.