DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and sft2d2b

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001018531.1 Gene:sft2d2b / 553724 ZFINID:ZDB-GENE-050522-336 Length:161 Species:Danio rerio


Alignment Length:130 Identity:43/130 - (33%)
Similarity:64/130 - (49%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RIVGFVACLGMGALCMTLST--FYIPFLILKARKFALLYTLGSLFFILSFCFLSGFGSFLKQMFS 123
            |:.||:||...|.||..|.|  .::|...|..  ||:.|:||::..:||..||.|....||:|..
Zfish    34 RVKGFLACFVSGVLCSILGTCLLWVPGKGLTL--FAVFYSLGNIASLLSTMFLMGPLKQLKRMCD 96

  Fly   124 KPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLFMVLGTVPGGATG-LKFFGQLFK 187
            |.|.|.:....:||:||...|...|:.|..:||.:.|.:|..:..:..:|..... :|.|....|
Zfish    97 KTRALATGIMITCLVLTFCAAFWWKNRALALLFCILQFLAFTWYSISYIPFARDAIIKLFSACLK 161

  Fly   188  187
            Zfish   162  161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 36/112 (32%)
sft2d2bNP_001018531.1 Got1 45..155 CDD:282085 35/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54203
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.