DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and sft2d1

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001005146.2 Gene:sft2d1 / 448736 XenbaseID:XB-GENE-946278 Length:160 Species:Xenopus tropicalis


Alignment Length:127 Identity:43/127 - (33%)
Similarity:63/127 - (49%) Gaps:6/127 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DSDSCFPKLSRLQRIVGFVACLGMGALCMTLSTFYIPFLILKARK-FALLYTLGSLFFILSFCFL 111
            ||.|    ||...|:..|..|...|..|..|.|.:: |:....:| ||:.||||::..:.|.|||
 Frog    24 DSSS----LSFGTRVKWFAICFVCGIACSILGTAFL-FIPAAGKKLFAVFYTLGNVAALASTCFL 83

  Fly   112 SGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLFMVLGTVP 173
            .|....||:||:..||:.:|....|||.||......:.....::|.:.|.||:.:..|..:|
 Frog    84 MGPVKQLKKMFAPTRLIATLVMLLCLICTLCAVFWWQKNGLAIIFCILQFIAMTWYSLSYIP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 35/103 (34%)
sft2d1NP_001005146.2 Got1 41..155 CDD:367854 35/106 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54203
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.