DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and sft2d3

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001157467.1 Gene:sft2d3 / 407688 ZFINID:ZDB-GENE-070907-1 Length:224 Species:Danio rerio


Alignment Length:231 Identity:78/231 - (33%)
Similarity:107/231 - (46%) Gaps:39/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNLKSDLDEYL---------LLQS--------DQKKPSFNVKLPQLKVPFFSSSDPEANS---- 44
            |:.|...|.|||         :.||        |...|.......:...||..||...|.|    
Zfish     1 MAELNRQLQEYLAHSKSGAKTISQSSSSTTIDVDGDVPVSGSWFGRWSSPFSGSSSRGATSGQGS 65

  Fly    45 -------FLKDSDSCFPKLSRLQRIVGFVACLGMGALCMTLSTFYIPFLILKARKFALLYTLGSL 102
                   :..:.|.|.|.|||.||:|.|..|:...|||..||..|.|.|:|||||||||::|||:
Zfish    66 SGGFSWPWSSEPDPCLPGLSRSQRLVAFGTCIFFSALCFGLSALYAPLLLLKARKFALLWSLGSV 130

  Fly   103 FFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLFM 167
            |.:|....|.|    ..::.:.|....:: |...|..|||.||...||..|.|.|..||.|::..
Zfish   131 FALLGAAILRG----PSKLIATPTPGAAV-YLCSLAGTLYAALSLHSTLLTALGACLQIAAIVGY 190

  Fly   168 VLGTVPGGATGLKFFGQL----FKNTVSASTSVLPV 199
            ::..:|||:.|::|.|.:    .|.||:..|  :|:
Zfish   191 IVALLPGGSAGMRFVGGMAASAIKRTVTGKT--MPI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 44/109 (40%)
sft2d3NP_001157467.1 Got1 100..205 CDD:282085 44/109 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587921
Domainoid 1 1.000 74 1.000 Domainoid score I9138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38341
Inparanoid 1 1.050 101 1.000 Inparanoid score I4982
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1371944at2759
OrthoFinder 1 1.000 - - FOG0004073
OrthoInspector 1 1.000 - - oto39337
orthoMCL 1 0.900 - - OOG6_103301
Panther 1 1.100 - - LDO PTHR23137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4444
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.