DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and CG5104

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649241.1 Gene:CG5104 / 40280 FlyBaseID:FBgn0037009 Length:163 Species:Drosophila melanogaster


Alignment Length:157 Identity:48/157 - (30%)
Similarity:76/157 - (48%) Gaps:8/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PEANSFLKDSDSCFPKLSRLQRIVGFVACLGMGALCMTLSTFYIPFLILKARKFALLYTLGSLFF 104
            ||..|.:....:....||...||.|||.|..:|.|...|.:..: ||......||:.||||::..
  Fly    15 PEEESSIITQINDMSTLSWSTRIKGFVICFALGILLSLLGSVAL-FLHRGIVVFAVFYTLGNVIS 78

  Fly   105 ILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLFMVL 169
            :.|.|||.|....:|:||::.||:.::.....::||...|:|.|....|::|.:.|.:|:.:..|
  Fly    79 MASTCFLMGPFKQIKKMFAETRLIATIIVLVMMVLTFIAAIVWKKAGLTLIFIIIQSLAMTWYSL 143

  Fly   170 GTVPGGATGLKFFGQLFKNTVSASTSV 196
            ..:|       :.....|.|:||...|
  Fly   144 SYIP-------YARDAVKKTMSAILEV 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 32/109 (29%)
CG5104NP_649241.1 Got1 58..155 CDD:282085 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5102
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23137
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1328
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.