DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and SFT2D2

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_955376.1 Gene:SFT2D2 / 375035 HGNCID:25140 Length:160 Species:Homo sapiens


Alignment Length:151 Identity:49/151 - (32%)
Similarity:69/151 - (45%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSSDPEANSFLKDSDSCFPKLSRLQRIVGFVACLGMGALCMTLST--FYIPFLILKARK----FA 94
            |..|.|..|.|.:.... ..||...||.||:||..:|.||..|.|  .::|      ||    ||
Human     9 SGQDTEDRSGLSEVVEA-SSLSWSTRIKGFIACFAIGILCSLLGTVLLWVP------RKGLHLFA 66

  Fly    95 LLYTLGSLFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVA 159
            :.||.|::..|.|..||.|....||:||...||:.::....|..|||..|....:....::|.:.
Human    67 VFYTFGNIASIGSTIFLMGPVKQLKRMFEPTRLIATIMVLLCFALTLCSAFWWHNKGLALIFCIL 131

  Fly   160 QIIALLFMVLGTVPGGATGLK 180
            |.:||.:..|..:|.....:|
Human   132 QSLALTWYSLSFIPFARDAVK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 36/115 (31%)
SFT2D2NP_955376.1 Got1 45..155 CDD:309343 35/114 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54203
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.