DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and Sft2d2

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001029183.1 Gene:Sft2d2 / 360868 RGDID:1310623 Length:157 Species:Rattus norvegicus


Alignment Length:150 Identity:50/150 - (33%)
Similarity:72/150 - (48%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSSDPEANSFLK---DSDSCFPKLSRLQRIVGFVACLGMGALCMTLSTFYIPFLILKARK--FAL 95
            |..|.|..|.|.   :|.|    ||...||.||:.|..:|.||..|.|    .|:..:||  ||:
  Rat     9 SGQDTEDRSGLSEVVESSS----LSWSTRIKGFIVCFALGILCSLLGT----LLLWVSRKGLFAV 65

  Fly    96 LYTLGSLFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQ 160
            .||||::..|.|..||.|....||:||...||:.::......:||| |:....:....::|.:.|
  Rat    66 FYTLGNITSIGSTMFLMGPLKQLKRMFEPTRLIATILVLLFFVLTL-CSAFLWNKGLALIFCILQ 129

  Fly   161 IIALLFMVLGTVPGGATGLK 180
            .:||.:..|..:|.....:|
  Rat   130 SLALTWYSLSYIPYARDAVK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 35/110 (32%)
Sft2d2NP_001029183.1 Got1 63..152 CDD:398033 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54203
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.