DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and F27D4.7

DIOPT Version :10

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001021422.1 Gene:F27D4.7 / 3565210 WormBaseID:WBGene00009191 Length:162 Species:Caenorhabditis elegans


Alignment Length:154 Identity:38/154 - (24%)
Similarity:65/154 - (42%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSDPEANSFLKDSDSCFPKLS-----------------RLQRIVGFVACLGMGALCMTLSTFYIP 84
            :||||..:.|..     |.:|                 |:|..||......:.:.|.:    |: 
 Worm     8 NSDPENPNNLNG-----PSISQESPSQPTVTTGMSWELRVQSFVGLFILSIIASFCGS----YL- 62

  Fly    85 FLILKARKFALLYTLGSLFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKS 149
            .|:.|...|.::.::.::..:.|.|.|.|....:|:||.|.|.:.|..|...:.|||...||.|:
 Worm    63 LLLTKITGFCIMTSISAILSLSSTCCLMGPIGQIKKMFDKSRWIASSMYILFIFLTLLSGLVLKN 127

  Fly   150 TAFTVLFAVAQIIALLFMVLGTVP 173
            :...::....|.||:.:..|..:|
 Worm   128 SLLAIICTAGQYIAMAWYSLSYIP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 62..173 CDD:461210 28/110 (25%)
F27D4.7NP_001021422.1 Got1 42..151 CDD:461210 29/113 (26%)

Return to query results.
Submit another query.