DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33635 and sftd-3

DIOPT Version :9

Sequence 1:NP_001027215.1 Gene:CG33635 / 3772540 FlyBaseID:FBgn0053635 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_495905.1 Gene:sftd-3 / 174427 WormBaseID:WBGene00007690 Length:235 Species:Caenorhabditis elegans


Alignment Length:169 Identity:69/169 - (40%)
Similarity:97/169 - (57%) Gaps:13/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FFSSSDPEANSFLKDSDSCFPKLSRLQRIVGFVACLGMGAL-CMTLSTFYIPFLILKARKFALLY 97
            :||.|..:.:.|         .::|.|||:.|..|: :||: |.:.:...||.:::..||||.|.
 Worm    77 WFSPSTQDESMF---------GMTRTQRIIAFFMCI-IGAIFCFSTAAVLIPVILVSTRKFAGLN 131

  Fly    98 TLGSLFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQII 162
            |||||..:|||.||.|..|:|..|.|..|.|.::||.|.|..|||.:|..|||.||::.|:.|..
 Worm   132 TLGSLLLLLSFAFLLGPKSYLTHMASPQRRLVTVSYLSALFATLYSSLWLKSTIFTLIAAIFQGF 196

  Fly   163 ALLFMVLGTVPGGATGLKFFGQLFKNTVSAST--SVLPV 199
            .|::.||..||||..||.|...||.:.:..||  :|||:
 Worm   197 TLVWYVLSYVPGGERGLFFMTSLFTSFLRRSTTSTVLPI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33635NP_001027215.1 Got1 72..182 CDD:282085 51/110 (46%)
sftd-3NP_495905.1 Got1 <81..225 CDD:295188 62/153 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162653
Domainoid 1 1.000 89 1.000 Domainoid score I5001
eggNOG 1 0.900 - - E1_COG5102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38341
Inparanoid 1 1.050 109 1.000 Inparanoid score I3475
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54203
OrthoDB 1 1.010 - - D1371944at2759
OrthoFinder 1 1.000 - - FOG0004073
OrthoInspector 1 1.000 - - oto18232
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23137
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.900

Return to query results.
Submit another query.