DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG34260

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:154 Identity:38/154 - (24%)
Similarity:69/154 - (44%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YTIAFTKT---QIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVN 76
            |.||. ||   ||.:.....:.:|..:.:..|.:...|  |:|:|.::..    ||...:.:|.:
  Fly    23 YDIAI-KTLGCQIIAKAYVNSLECLLVRQRTAVVAVKF--SLNQTIEHFD----VLATFDLIKKD 80

  Fly    77 FGLHQQINGYKPFLYNITIDGCQFMKNT-KSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTS 140
               ..::|     :.:|.||||:::.:. ::|:|.|.| ..::::|||..|||.:...:.|....
  Fly    81 ---KSRMN-----IADIKIDGCKYLGSMYQNNIVGKLF-KRLKSVSNLPDSCPVSKGKLYEIRNY 136

  Fly   141 ETINSRLPKTLPFPTGNYMFQTYW 164
            ..|:...|...|        |..|
  Fly   137 TFISDEFPPGAP--------QAKW 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 20/76 (26%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.